- Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0657 (AF_0657)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1007842
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,631 Da
- E Coli or Yeast
- 24-145
- Uncharacterized protein AF_0657 (AF_0657)
Sequence
EDEIVTVEGWLTYYDEEKKSWIPLERAQVTIYVDGREVGKAETNEYGMFTFAFPAPYKGRHKLEVRFKGKAGYESSSKSLDFQVMEREQKLKLGRLARDVLLLIIALVFLLFVAIFITNMLR